{ "action" : "rerender" }, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ Execute whatever should happen when entering the right sequence "action" : "rerender" "componentId" : "forums.widget.message-view", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_49","feedbackSelector":".InfoMessage"}); { ] "triggerSelector" : ".lia-panel-dialog-trigger-event-click", "}); "action" : "rerender" }); "eventActions" : [ ] { "actions" : [ "actions" : [ ] }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_49","feedbackSelector":".InfoMessage"}); ] "forceSearchRequestParameterForBlurbBuilder" : "false", { "messageViewOptions" : "1111110111111111111110111110100101001101" "actions" : [ LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1804514 .lia-rating-control-passive', '#form_5'); } "useSubjectIcons" : "true", "componentId" : "forums.widget.message-view", { clearWarning(pagerId); "useSimpleView" : "false", { } "actions" : [ ], ] { ] LITHIUM.StarRating('#any_1', false, 1, 'LITHIUM:starRating'); ] LITHIUM.MessageBodyDisplay('#bodyDisplay_6', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); }, "messageViewOptions" : "1111110111111111111110111110100101011101" ] "context" : "", "componentId" : "kudos.widget.button", "actions" : [ } ] "action" : "addClassName" } "closeImageIconURL" : "https://forum.vodafone.de/skins/images/767B9E5D691D46035B0CB025156F3D71/responsive_peak/images/button_dialog_close.svg", }, "action" : "rerender" { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_37","feedbackSelector":".InfoMessage"}); "message" : "1804514", "useCountToKudo" : "false", "action" : "rerender" "context" : "", { LITHIUM.Dialog.options['-1944332243'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "event" : "MessagesWidgetEditAction", }, "event" : "unapproveMessage", { "disableKudosForAnonUser" : "false", "event" : "ProductMessageEdit", "event" : "ProductMessageEdit", { // just for convenience, you need a login anyways... "context" : "envParam:quiltName,product,contextId,contextUrl", "truncateBody" : "true", "event" : "RevokeSolutionAction", LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); "action" : "pulsate" ] "action" : "rerender" { } { "event" : "removeMessageUserEmailSubscription", "action" : "rerender" if ( watching ) { "selector" : "#kudosButtonV2_8", ] "entity" : "1622809", }, } }, } // We made it! } "event" : "approveMessage", "context" : "envParam:quiltName,expandedQuiltName", "event" : "MessagesWidgetEditAction", ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); } { } ] "actions" : [ { "context" : "", } ] "forceSearchRequestParameterForBlurbBuilder" : "false", ], LITHIUM.MessageBodyDisplay('#bodyDisplay_7', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "action" : "rerender" { } "event" : "RevokeSolutionAction", var key = e.keyCode; ] }, }, "kudosLinksDisabled" : "false", "selector" : "#messageview_1", "initiatorDataMatcher" : "data-lia-kudos-id" ] "context" : "envParam:feedbackData", "event" : "approveMessage", } { ', 'ajax'); }, "linkDisabled" : "false" { } "action" : "rerender" { "useSimpleView" : "false", "event" : "unapproveMessage", lithadmin: [] "truncateBody" : "true", } "actions" : [ LITHIUM.InputEditForm("form", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { "action" : "rerender" LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; { "action" : "rerender" { }, ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "useCountToKudo" : "false", "context" : "", "event" : "unapproveMessage", ] LITHIUM.StarRating('#any_5', false, 1, 'LITHIUM:starRating'); "event" : "editProductMessage", "useCountToKudo" : "false", } var clickHandler = function(event) { "action" : "rerender" "displaySubject" : "true", ] '; "linkDisabled" : "false" } $(document).keydown(function(e) { "initiatorBinding" : true, "actions" : [ "actions" : [ ], { { { "action" : "rerender" "event" : "MessagesWidgetAnswerForm", { "entity" : "1804742", "initiatorDataMatcher" : "data-lia-kudos-id" Laut Aussage des Technikers, liegt eine Störung bei Vodafone vor. LITHIUM.AjaxSupport.fromForm('#form_8', 'GiveRating', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "context" : "envParam:quiltName", "action" : "rerender" "event" : "removeThreadUserEmailSubscription", "event" : "MessagesWidgetMessageEdit", }, LITHIUM.AjaxSupport.ComponentEvents.set({ } }, '; "action" : "rerender" "action" : "pulsate" Bist du sicher, dass du fortfahren möchtest? "actions" : [ "actions" : [ { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_40","feedbackSelector":".InfoMessage"}); "action" : "rerender" { "event" : "MessagesWidgetAnswerForm", "event" : "deleteMessage", { { "action" : "rerender" "truncateBodyRetainsHtml" : "false", "selector" : "#messageview_7", "actions" : [ "useSimpleView" : "false", "action" : "addClassName" }, }; }, { "event" : "unapproveMessage", }, "actions" : [ { }, "eventActions" : [ "context" : "envParam:quiltName", LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_72500b4e2510d2","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/Archiv_CallYa/thread-id/63406&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); } "messageViewOptions" : "1111110111111111111110111110100101001101" "message" : "2004287", setWarning(pagerId); }); { } { "parameters" : { "action" : "rerender" "event" : "markAsSpamWithoutRedirect", } { "quiltName" : "ForumMessage", "truncateBodyRetainsHtml" : "false", "entity" : "1622809", "event" : "ProductAnswer", ] "actions" : [ "parameters" : { "action" : "rerender" { "action" : "rerender" "event" : "QuickReply", ","loaderSelector":"#lineardisplaymessageviewwrapper_8 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "context" : "", "context" : "envParam:entity", { { { "event" : "ProductAnswerComment", } "context" : "", "action" : "rerender" "context" : "envParam:quiltName,message,product,contextId,contextUrl", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/63406","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Mrf6LaYSJTHDJCq8pROUuq8PTo8MSmaXR02IOlrRm7k. }); "event" : "unapproveMessage", } { }, }, ] "actions" : [ { "useCountToKudo" : "false", "initiatorDataMatcher" : "data-lia-kudos-id" "initiatorDataMatcher" : "data-lia-kudos-id" "activecastFullscreen" : false, }, { }); "event" : "MessagesWidgetEditAction", "closeImageIconURL" : "https://forum.vodafone.de/skins/images/767B9E5D691D46035B0CB025156F3D71/responsive_peak/images/button_dialog_close.svg", "}); { LITHIUM.AjaxSupport.ComponentEvents.set({ ] "event" : "removeThreadUserEmailSubscription", ] "action" : "rerender" { }, "context" : "", "event" : "MessagesWidgetEditAnswerForm", } "context" : "", { { { ] ] "context" : "lia-deleted-state", } "disableLinks" : "false", "kudosLinksDisabled" : "false", "parameters" : { { "context" : "", "quiltName" : "ForumMessage", ] Die Gutschrift wird gegen die gesamte Mobilfunkrechnung gebucht, bis diese aufgebraucht ist. ] { ;(function($) { "disableLabelLinks" : "false", "componentId" : "forums.widget.message-view", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1622809,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. return true; } }, }, Rufnummernmitnahme - Anbieter wechseln & Nummer behalten Sie möchten einen neuen Handytarif abschließen, aber trotzdem Ihre bisherige Rufnummer behalten? $('#vodafone-community-header').toggle(); "actions" : [ "action" : "rerender" "useTruncatedSubject" : "true", "event" : "MessagesWidgetCommentForm", { ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_35","feedbackSelector":".InfoMessage"}); "context" : "", "event" : "RevokeSolutionAction", "}); "actions" : [ "event" : "RevokeSolutionAction", "actions" : [ "selector" : "#kudosButtonV2_8", "action" : "rerender" // We made it! "context" : "envParam:quiltName,message", "componentId" : "kudos.widget.button", } "action" : "rerender" }, "event" : "QuickReply", LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); "eventActions" : [ { }, "action" : "rerender" } ], return false; }, LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "actions" : [ "; "action" : "rerender" "action" : "rerender" { // We're good so far. Bist du sicher, dass du fortfahren möchtest? { }, if($('body.lia-window-scroll #vodafone-community-header .lia-search-input-wrapper').css('opacity') > 0) { ', 'ajax'); ] "action" : "rerender" { { "context" : "", }, "event" : "addThreadUserEmailSubscription", ] }, ] { } ] }, "event" : "approveMessage", "displayStyle" : "horizontal", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_47","feedbackSelector":".InfoMessage"}); "event" : "deleteMessage", { { "showCountOnly" : "false", "parameters" : { }, } { "event" : "MessagesWidgetEditAnswerForm", { { { { { { // --> "action" : "rerender" { window.location = "https://forum.vodafone.de/t5/Archiv-CallYa/Was-muss-man-tun-um-die-Gutschrift-bei-Rufnummernmitnahme-zu/td-p/1622795" + "/page/" + val; "event" : "markAsSpamWithoutRedirect", }, "closeEvent" : "LITHIUM:lightboxCloseEvent", "actions" : [ $(document).keydown(function(e) { "initiatorBinding" : true, "action" : "rerender" { ;(function($) { "includeRepliesModerationState" : "false", ] { "action" : "pulsate" } } LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1622813 .lia-rating-control-passive', '#form_1'); } { "context" : "envParam:entity", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_8","componentSelector":"#lineardisplaymessageviewwrapper_8","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1999487,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "action" : "pulsate" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_42","feedbackSelector":".InfoMessage"}); "initiatorDataMatcher" : "data-lia-message-uid" { "disallowZeroCount" : "false", o.innerHTML = "Page number must be 1 or greater. ] LITHIUM.AjaxSupport.ComponentEvents.set({ setWarning(pagerId); "actions" : [ }, "useSimpleView" : "false", "revokeMode" : "true", "event" : "MessagesWidgetEditAction", "message" : "1999487", { "displayStyle" : "horizontal", { } "event" : "QuickReply", "context" : "envParam:feedbackData", "action" : "rerender" ] { }, "actions" : [ "action" : "rerender" ] "action" : "rerender" "context" : "", } LITHIUM.Auth.CHECK_SESSION_TOKEN = '06OTdjSRvVXWx5BH9IUjHPH3QwrBqYTDT0rWQae4e0E. "truncateBodyRetainsHtml" : "false", }, return; } "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_35","feedbackSelector":".InfoMessage"}); } ] })(LITHIUM.jQuery); watching = false; "actions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1804742 .lia-rating-control-passive', '#form_7'); } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "deleteMessage", if ( Number(val) < 1 ) } "action" : "rerender" ] "context" : "", "actions" : [ "action" : "rerender" { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); "disallowZeroCount" : "false", } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, { } ] { { "componentId" : "forums.widget.message-view", "actions" : [ "event" : "MessagesWidgetMessageEdit", ] }, }, // We're good so far. LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1804742 .lia-rating-control-passive', '#form_7'); //$('#vodafone-community-header .lia-search-input-wrapper').css('display','table-cell')} count++; }, "forceSearchRequestParameterForBlurbBuilder" : "false",